| Description | Tripartite motif-containing protein 66 |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 172 |
| Binding Area (Å2) | 593.22 |
| Molecular Weight | - |
| Aromaticity | 0.10 |
| Instability | - |
| Isoelectric Point | 6.68 |
| Sequence | PHMENEDFCAVCLNGGELLCCDRCPKVFHLSCHVPALTSFPGGEWVCTLCRSLSPGLSMYDQKKCEKLVLSLCCNNLSLPFHEPVSPLARHYYQIIKRPMDLSTIRRKLQKKDPAHYTTPEEVVSDVRLMFWNCAKFNYPDSEVAEAGRSLENFFEGWLKEIYPEKRFAQXX |
| Description | ALA-ARG-THR-LYS-GLN-THR-ALA-ARG-LYS-SER-THR-GLY |
|---|---|
| Organism | Homo sapiens |
| Chain | C |
| Length | 10 |
| Binding Area (Å2) | 794.41 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1146.30 |
| Aromaticity | 0.00 |
| Instability | 32.64 |
| Isoelectric Point | 12.02 |
| Sequence | ARTKQTARKS |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S46) |
Contact cluster (C422) |
Interface cluster (I1598) |
|---|---|---|---|
| 3o37-F-B | |||
| 2h9m-B-A | |||
| 4lk9-B-A | |||
| 2ke1-B-A | |||
| 4ouc-B-A | |||
| 2lgg-B-A | |||
| 4qbr-P-A | |||
| 2puy-E-B | |||
| 4qbr-E-C | |||
| 3asl-B-A | |||
| 5f6k-M-C | |||
| 5fb1-C-A | |||
| 3qlc-C-A | |||
| 5hh7-P-A | |||
| 3shb-B-A | |||
| 6e83-A-B | |||
| 3sou-D-A | |||
| 3sou-E-B | |||
| 3uef-B-A | |||
| 3v43-Q-A | |||
| 3zvy-C-A | |||
| 3zvy-D-B | |||
| 2co0-B-A | |||
| 4gne-B-A | |||
| 2co0-D-C | |||
| 4gnf-C-A |