| Description | Eukaryotic translation initiation factor 4E type 2 |
|---|---|
| Organism | Homo sapiens |
| Chain | C |
| Length | 166 |
| Binding Area (Å2) | 1267.01 |
| Molecular Weight | 19391.02 |
| Aromaticity | 0.11 |
| Instability | 43.25 |
| Isoelectric Point | 8.59 |
| Sequence | GPHMLEAEHPLQYNYTFWYSRRNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMP |
| Description | Eukaryotic translation initiation factor 4E-binding protein 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | D |
| Length | 35 |
| Binding Area (Å2) | 1396.17 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 4034.73 |
| Aromaticity | 0.06 |
| Instability | 50.82 |
| Isoelectric Point | 9.78 |
| Sequence | MTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTS |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S193) |
Contact cluster (C22) |
Interface cluster (I1439) |
|---|---|---|---|
| 3m94-C-A | |||
| 1ej4-B-A | |||
| 3u7x-C-A | |||
| 3u7x-D-B | |||
| 4ued-B-A | |||
| 2jgc-B-A | |||
| 2v8w-B-A | |||
| 2v8x-B-A | |||
| 2v8y-B-A | |||
| 1ejh-E-A | |||
| 1ejh-F-B | |||
| 4ue9-B-A | |||
| 1ejh-G-C | |||
| 1ejh-H-D | |||
| 5aby-B-A | |||
| 1wkw-B-A | |||
| 5ehc-B-A | |||
| 5ei3-B-A | |||
| 5me5-B-A | |||
| 5t48-B-A | |||
| 5xln-B-A | |||
| 2w97-E-A | |||
| 2w97-F-B | |||
| 3am7-B-A | |||
| 3hxg-C-A | |||
| 3hxi-C-A |