| Description | Translation initiation factor 4E |
|---|---|
| Organism | Ascaris suum |
| Chain | A |
| Length | 181 |
| Binding Area (Å2) | 662.83 |
| Molecular Weight | - |
| Aromaticity | 0.11 |
| Instability | - |
| Isoelectric Point | 5.96 |
| Sequence | MRHPLQCHWALWYLKADRSKDWEDCLKQVAVFDTVEDFWSLYNHIQAASGLTWGSDYYLFKEGIKPMWEDENNVKGGRWLVVVDKQKRAQLLDHYWLELLMAIIGEQFEDNGEYICGAVVNVRQKGDKVSLWTRDSLKDDVNLRIGQILKAKLEIPDTEPIRYEVHKTGSMVKPRIVIPSX |
| Description | Eukaryotic translation initiation factor 4E-binding protein 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | C |
| Length | 13 |
| Binding Area (Å2) | 716.37 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1743.10 |
| Aromaticity | 0.15 |
| Instability | 55.45 |
| Isoelectric Point | 9.31 |
| Sequence | RIIYDRKFLMECR |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S193) |
Contact cluster (C22) |
Interface cluster (I30) |
|---|---|---|---|
| 2v8w-B-A | |||
| 2v8x-B-A | |||
| 2v8y-B-A | |||
| 3u7x-C-A | |||
| 1ej4-B-A | |||
| 3u7x-D-B | |||
| 1ejh-F-B | |||
| 1ejh-G-C | |||
| 1ejh-H-D | |||
| 5ehc-B-A | |||
| 1wkw-B-A | |||
| 5ei3-B-A | |||
| 2w97-E-A | |||
| 2w97-F-B | |||
| 3am7-B-A | |||
| 1ejh-E-A | |||
| 4ued-B-A | |||
| 2jgc-B-A | |||
| 5nvn-D-C | |||
| 5aby-B-A | |||
| 5me5-B-A | |||
| 5t48-B-A | |||
| 5xln-B-A | |||
| 4ue9-B-A | |||
| 3hxg-C-A | |||
| 3hxi-C-A |