| Description | Chaperone protein dnaK |
|---|---|
| Organism | Escherichia coli |
| Chain | A |
| Length | 115 |
| Binding Area (Å2) | 450.03 |
| Molecular Weight | 12228.69 |
| Aromaticity | 0.03 |
| Instability | 36.25 |
| Isoelectric Point | 6.31 |
| Sequence | DVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGL |
| Description | peptide NRLLLTG |
|---|---|
| Organism | - |
| Chain | B |
| Length | 7 |
| Binding Area (Å2) | 598.84 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 785.93 |
| Aromaticity | 0.00 |
| Instability | -3.56 |
| Isoelectric Point | 9.75 |
| Sequence | NRLLLTG |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S183) |
Contact cluster (C661) |
Interface cluster (I24) |
|---|---|---|---|
| 1dkz-B-A | |||
| 4r5i-B-A | |||
| 4ezw-E-A | |||
| 4ezw-F-B | |||
| 4ezw-G-C | |||
| 4ezw-H-D | |||
| 4ezx-C-A | |||
| 4ezx-D-B | |||
| 4ezy-B-A | |||
| 1dkx-B-A | |||
| 4f00-B-A | |||
| 4jwd-C-B | |||
| 4ezo-C-A | |||
| 4ezp-C-A | |||
| 4ezq-B-A | |||
| 4ezr-B-A | |||
| 4ezs-B-A | |||
| 4ezt-B-A | |||
| 4ezu-B-A | |||
| 4ezz-B-A | |||
| 4po2-C-A | |||
| 4po2-D-B |