| Description | Chaperone protein DnaK |
|---|---|
| Organism | Escherichia coli |
| Chain | A |
| Length | 218 |
| Binding Area (Å2) | 543.52 |
| Molecular Weight | 23718.43 |
| Aromaticity | 0.02 |
| Instability | 39.65 |
| Isoelectric Point | 5.11 |
| Sequence | VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH |
| Description | Drosocin |
|---|---|
| Organism | Drosophila melanogaster |
| Chain | B |
| Length | 8 |
| Binding Area (Å2) | 683.10 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 961.12 |
| Aromaticity | 0.00 |
| Instability | 19.80 |
| Isoelectric Point | 12.00 |
| Sequence | SHPRPIRV |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S1381) |
Contact cluster (C28) |
Interface cluster (I24) |
|---|---|---|---|
| 4ezw-G-C | |||
| 4ezw-H-D | |||
| 4ezx-C-A | |||
| 4ezx-D-B | |||
| 4ezy-B-A | |||
| 1dkx-B-A | |||
| 4ezz-B-A | |||
| 1dkz-B-A | |||
| 4f00-B-A | |||
| 4jwd-C-B | |||
| 4ezo-C-A | |||
| 4ezp-C-A | |||
| 4ezq-B-A | |||
| 4r5i-B-A | |||
| 4ezs-B-A | |||
| 4ezt-B-A | |||
| 4ezu-B-A | |||
| 4ezw-E-A | |||
| 4ezw-F-B | |||
| 1q5l-B-A | |||
| 4po2-C-A | |||
| 4po2-D-B |