Description | Chaperone protein dnaK |
---|---|
Organism | Escherichia coli |
Chain | A |
Length | 115 |
Binding Area (Å2) | 450.03 |
Molecular Weight | 12228.69 |
Aromaticity | 0.03 |
Instability | 36.25 |
Isoelectric Point | 6.31 |
Sequence | DVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGL |
Description | peptide NRLLLTG |
---|---|
Organism | - |
Chain | B |
Length | 7 |
Binding Area (Å2) | 598.84 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 785.93 |
Aromaticity | 0.00 |
Instability | -3.56 |
Isoelectric Point | 9.75 |
Sequence | NRLLLTG |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S183) |
Contact cluster (C664) |
Interface cluster (I24) |
---|---|---|---|
4ezw-H-D | |||
4ezx-C-A | |||
4ezx-D-B | |||
4ezy-B-A | |||
1dkx-B-A | |||
1dkz-B-A | |||
4r5i-B-A | |||
4ezw-E-A | |||
4ezw-F-B | |||
4ezw-G-C | |||
4ezz-B-A | |||
4f00-B-A | |||
4ezo-C-A | |||
4jwd-C-B | |||
4ezp-C-A | |||
4ezq-B-A | |||
4ezr-B-A | |||
4ezs-B-A | |||
4ezt-B-A | |||
4ezu-B-A | |||
4po2-C-A | |||
4po2-D-B |