Description | Chaperone protein DnaK |
---|---|
Organism | Escherichia coli |
Chain | B |
Length | 214 |
Binding Area (Å2) | 495.75 |
Molecular Weight | 23196.90 |
Aromaticity | 0.02 |
Instability | 38.40 |
Isoelectric Point | 5.03 |
Sequence | VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA |
Description | Cathelicidin-3 |
---|---|
Organism | Bos taurus |
Chain | C |
Length | 7 |
Binding Area (Å2) | 684.01 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 822.99 |
Aromaticity | 0.14 |
Instability | 107.86 |
Isoelectric Point | 10.18 |
Sequence | PRPLPFP |
Is the complex classified in the same cluster?