Description | Protein lgg-2 |
---|---|
Organism | Caenorhabditis elegans |
Chain | A |
Length | 117 |
Binding Area (Å2) | 400.78 |
Molecular Weight | 13772.65 |
Aromaticity | 0.09 |
Instability | 90.59 |
Isoelectric Point | 8.48 |
Sequence | PGSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG |
Description | TRP-GLU-GLU-LEU |
---|---|
Organism | Scheffersomyces stipitis |
Chain | H |
Length | 4 |
Binding Area (Å2) | 571.98 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 575.61 |
Aromaticity | 0.25 |
Instability | 89.00 |
Isoelectric Point | 3.79 |
Sequence | WEEL |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S55) |
Contact cluster (C1486) |
Interface cluster (I39) |
---|---|---|---|
5e6o-G-C | |||
5cx3-E-A | |||
5cx3-F-B | |||
5cx3-G-C | |||
5cx3-H-D | |||
5d94-B-A | |||
5dpw-H-G | |||
5dpw-J-I | |||
5dpw-N-M | |||
5wrd-C-A | |||
2k6q-B-A | |||
5yis-D-B | |||
2zjd-B-A | |||
2zjd-D-C | |||
5b1z-C-A | |||
5b1z-D-B | |||
5fcg-C-A | |||
5azf-C-A |