Description | Vitamin D3 receptor A |
---|---|
Organism | Danio rerio |
Chain | A |
Length | 239 |
Binding Area (Å2) | 548.22 |
Molecular Weight | - |
Aromaticity | 0.07 |
Instability | - |
Isoelectric Point | 5.92 |
Sequence | MLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVSX |
Description | Nuclear receptor coactivator 1 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 11 |
Binding Area (Å2) | 622.87 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1442.71 |
Aromaticity | 0.00 |
Instability | 105.06 |
Isoelectric Point | 10.84 |
Sequence | RHKILHRLLQE |
Is the complex classified in the same cluster?