Description | Vitamin D3 receptor |
---|---|
Organism | Rattus norvegicus |
Chain | A |
Length | 242 |
Binding Area (Å2) | 409.19 |
Molecular Weight | - |
Aromaticity | 0.07 |
Instability | - |
Isoelectric Point | 5.92 |
Sequence | KLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEX |
Description | DRIP 205 NR2 box peptide |
---|---|
Organism | synthetic construct |
Chain | C |
Length | 9 |
Binding Area (Å2) | 474.24 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1074.36 |
Aromaticity | 0.00 |
Instability | -8.92 |
Isoelectric Point | 6.51 |
Sequence | PMLMNLLKD |
Is the complex classified in the same cluster?