Description | Retinoic acid receptor beta |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 242 |
Binding Area (Å2) | 466.36 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 5.69 |
Sequence | ESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMMEXX |
Description | Steroid Receptor Coactivator 1 |
---|---|
Organism | Homo sapiens |
Chain | F |
Length | 11 |
Binding Area (Å2) | 539.47 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1442.71 |
Aromaticity | 0.00 |
Instability | 105.06 |
Isoelectric Point | 10.84 |
Sequence | RHKILHRLLQE |
Is the complex classified in the same cluster?