Description | Ancestral Glucocorticoid Receptor 2 |
---|---|
Organism | synthetic construct |
Chain | A |
Length | 247 |
Binding Area (Å2) | 543.01 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 8.05 |
Sequence | PTLISLLEVIEPEVLYSGYDSTLPDTSTRLMSTLNRLGGRQVVSAVKWAKALPGFRNLHLDDQMTLLQYSWMSLMAFSLGWRSYKQSNGNMLCFAPDLVINEERMQLPYMYDQCQQMLKISSEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEMVGGLLQFCFYTFVNKSSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 11 |
Binding Area (Å2) | 578.72 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1333.53 |
Aromaticity | 0.09 |
Instability | 12.03 |
Isoelectric Point | 6.14 |
Sequence | NALLRYLLDKD |
Is the complex classified in the same cluster?