Description | Androgen receptor |
---|---|
Organism | Pan troglodytes |
Chain | A |
Length | 250 |
Binding Area (Å2) | 467.32 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 8.94 |
Sequence | QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTX |
Description | WxxLF motif peptide |
---|---|
Organism | - |
Chain | B |
Length | 8 |
Binding Area (Å2) | 520.15 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1022.11 |
Aromaticity | 0.25 |
Instability | 119.85 |
Isoelectric Point | 5.81 |
Sequence | SRWQALFD |
Is the complex classified in the same cluster?