Description | Bak protein |
---|---|
Organism | Singapore grouper iridovirus |
Chain | A |
Length | 116 |
Binding Area (Å2) | 815.31 |
Molecular Weight | - |
Aromaticity | 0.09 |
Instability | - |
Isoelectric Point | 6.79 |
Sequence | INFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILEIGNNIVSDGNLNWGRILILLGISQLYFTKSESESERTQITEQLERFFRQDAISNWIASNGGWVTCASLX |
Description | Bcl-2 interacting mediator of cell death |
---|---|
Organism | Danio rerio |
Chain | B |
Length | 24 |
Binding Area (Å2) | 915.94 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 2848.31 |
Aromaticity | 0.08 |
Instability | 64.77 |
Isoelectric Point | 6.29 |
Sequence | ALPPEMVVARELRRIGDEFNRLYC |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S35) |
Contact cluster (C1402) |
Interface cluster (I1466) |
---|---|---|---|
4bd6-C-A | |||
6mbc-B-A | |||
1bxl-B-A | |||
4uf1-B-A | |||
6qg8-B-A | |||
1g5j-B-A | |||
4zif-B-A | |||
2jby-B-A | |||
4zih-B-A | |||
2jm6-A-B | |||
5c6h-B-A | |||
2m04-B-A | |||
5fmk-B-A | |||
2roc-B-A | |||
5twa-D-A | |||
2rod-B-A | |||
5twa-C-B | |||
2v6q-B-A | |||
5tzp-B-A | |||
2vog-B-A | |||
5tzq-C-B | |||
2voh-B-A | |||
5tzq-D-A | |||
2wh6-B-A | |||
5ua5-B-A | |||
2xpx-B-A | |||
5uuk-B-A | |||
3i1h-B-A | |||
5uum-C-A | |||
3io8-D-C | |||
5uum-D-B | |||
3mqp-B-A | |||
6fbx-B-A |