Description | Bcl-2-related protein A1 |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 152 |
Binding Area (Å2) | 1056.62 |
Molecular Weight | 17425.75 |
Aromaticity | 0.12 |
Instability | 20.61 |
Isoelectric Point | 5.27 |
Sequence | GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK |
Description | dF4 |
---|---|
Organism | synthetic construct |
Chain | B |
Length | 23 |
Binding Area (Å2) | 1230.95 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 2783.25 |
Aromaticity | 0.09 |
Instability | 41.71 |
Isoelectric Point | 8.07 |
Sequence | SLLEKLAEYLRQMADEINKKYVK |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S35) |
Contact cluster (C84) |
Interface cluster (I84) |
---|---|---|---|
3i1h-B-A | |||
5uuk-B-A | |||
3mqp-B-A | |||
2vog-B-A | |||
2voh-B-A | |||
4zeq-B-A | |||
2vm6-B-A | |||
2voi-B-A | |||
2wh6-B-A | |||
5tzq-D-A | |||
2xpx-B-A | |||
5ua5-B-A | |||
3io8-D-C | |||
5uum-C-A | |||
1bxl-B-A | |||
5uum-D-B | |||
1g5j-B-A | |||
4bd6-C-A | |||
5vmo-B-A | |||
2jby-B-A | |||
4uf1-B-A | |||
6fbx-B-A | |||
2jm6-A-B | |||
6qg8-B-A | |||
2m04-B-A | |||
4zif-B-A | |||
2roc-B-A | |||
4zih-B-A | |||
2rod-B-A | |||
5c6h-B-A | |||
2v6q-B-A | |||
5fmk-B-A | |||
5twa-D-A | |||
5twa-C-B | |||
5tzp-B-A | |||
5tzq-C-B |