Description | TPR repeat-containing protein associated with Hsp90 |
---|---|
Organism | Saccharomyces cerevisiae |
Chain | A |
Length | 110 |
Binding Area (Å2) | 426.90 |
Molecular Weight | 12379.84 |
Aromaticity | 0.08 |
Instability | 29.77 |
Isoelectric Point | 6.08 |
Sequence | SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS |
Description | ATP-dependent molecular chaperone HSP82 |
---|---|
Organism | Saccharomyces cerevisiae |
Chain | B |
Length | 9 |
Binding Area (Å2) | 531.04 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1038.04 |
Aromaticity | 0.00 |
Instability | 23.68 |
Isoelectric Point | 3.60 |
Sequence | ADTEMEEVD |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S148) |
Contact cluster (C903) |
Interface cluster (I866) |
---|---|---|---|
3lca-Q-A | |||
3m5m-C-B | |||
4aif-D-A | |||
4aif-E-B | |||
4cgq-Q-A | |||
4cgu-C-A | |||
5mgx-A-F | |||
5mgx-B-G | |||
5mgx-C-E | |||
5mgx-D-H | |||
5njx-B-A | |||
6fdp-B-A | |||
1elr-B-A | |||
6hpg-a-A | |||
2bug-B-A | |||
6hpg-c-C | |||
2l6j-B-A | |||
6hpg-d-D | |||
3fp2-Q-A | |||
6hpg-e-E |