6HPG-E-E

PDB Title ARABIDOPSIS OM64 TPR DOMAIN
Resolution (Å) 2.000
Classification PLANT PROTEIN

Protein

Description Outer envelope protein 64, mitochondrial
Organism Arabidopsis thaliana
Chain E
Length 117
Binding Area (Å2) 419.02
Molecular Weight 13230.07
Aromaticity 0.09
Instability 33.55
Isoelectric Point 9.41
Sequence GNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAFLELCCFQQAEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAAADFRHALVLEPQNKTAKVAEKRL

Peptide

Description Heat shock protein 90-4
Organism Arabidopsis thaliana
Chain e
Length 7
Binding Area (Å2) 554.82
Hydrophobic (% a.a.)
28%
Molecular Weight 836.91
Aromaticity 0.00
Instability 80.24
Isoelectric Point 4.38
Sequence SKMEEVD

Clustering Classification

Sequence cluster S 148
Contact cluster C197
Interface cluster I219

Similar complexes

Is the complex classified in the same cluster?

Complex Sequence cluster
(S148)
Contact cluster
(C197)
Interface cluster
(I219)
6hpg-a-A
6hpg-c-C
6hpg-d-D
5mgx-B-G
5mgx-C-E
5mgx-D-H
5njx-B-A
1elr-B-A
6fdp-B-A
2bug-B-A
2l6j-B-A
2lsv-B-A
3fp2-Q-A
3lca-Q-A
3m5m-C-B
4aif-D-A
4aif-E-B
4cgq-Q-A
4cgu-C-A
5mgx-A-F