| Description | TPR repeat-containing protein associated with Hsp90 |
|---|---|
| Organism | Saccharomyces cerevisiae |
| Chain | A |
| Length | 110 |
| Binding Area (Å2) | 426.90 |
| Molecular Weight | 12379.84 |
| Aromaticity | 0.08 |
| Instability | 29.77 |
| Isoelectric Point | 6.08 |
| Sequence | SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS |
| Description | ATP-dependent molecular chaperone HSP82 |
|---|---|
| Organism | Saccharomyces cerevisiae |
| Chain | B |
| Length | 9 |
| Binding Area (Å2) | 531.04 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1038.04 |
| Aromaticity | 0.00 |
| Instability | 23.68 |
| Isoelectric Point | 3.60 |
| Sequence | ADTEMEEVD |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S148) |
Contact cluster (C903) |
Interface cluster (I866) |
|---|---|---|---|
| 3lca-Q-A | |||
| 3m5m-C-B | |||
| 4aif-D-A | |||
| 4aif-E-B | |||
| 4cgq-Q-A | |||
| 4cgu-C-A | |||
| 5mgx-A-F | |||
| 5mgx-B-G | |||
| 5mgx-C-E | |||
| 5mgx-D-H | |||
| 5njx-B-A | |||
| 6fdp-B-A | |||
| 1elr-B-A | |||
| 6hpg-a-A | |||
| 2bug-B-A | |||
| 6hpg-c-C | |||
| 2l6j-B-A | |||
| 6hpg-d-D | |||
| 3fp2-Q-A | |||
| 6hpg-e-E |