| Description | SH3 and cysteine-rich domain-containing protein 2 |
|---|---|
| Organism | Homo sapiens |
| Chain | F |
| Length | 112 |
| Binding Area (Å2) | 419.09 |
| Molecular Weight | 12666.29 |
| Aromaticity | 0.11 |
| Instability | 37.77 |
| Isoelectric Point | 8.53 |
| Sequence | NSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRGFIRVSSGKKRGLVPVDALTEI |
| Description | Voltage-dependent L-type calcium channel subunit alpha-1S |
|---|---|
| Organism | Homo sapiens |
| Chain | L |
| Length | 9 |
| Binding Area (Å2) | 527.39 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1005.17 |
| Aromaticity | 0.00 |
| Instability | 108.24 |
| Isoelectric Point | 6.43 |
| Sequence | PEIPLSPRP |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S146) |
Contact cluster (C124) |
Interface cluster (I147) |
|---|---|---|---|
| 6b27-I-C | |||
| 6b27-J-D | |||
| 6b27-K-E | |||
| 6b27-G-A | |||
| 6b27-H-B | |||
| 1qvo-C-A | |||
| 1qvo-F-D | |||
| 3rl2-C-A | |||
| 4l1u-J-F | |||
| 4lnr-C-A | |||
| 4o56-B-A | |||
| 4u1k-C-A | |||
| 4u1k-F-D | |||
| 4u1l-C-A | |||
| 4u1l-F-D | |||
| 4u1m-C-A | |||
| 4u1n-C-A | |||
| 5eo0-C-A | |||
| 5eo1-C-A | |||
| 1a1n-C-A |