| Description | RNA polymerase-associated protein RTF1 homolog |
|---|---|
| Organism | Homo sapiens |
| Chain | F |
| Length | 134 |
| Binding Area (Å2) | 205.83 |
| Molecular Weight | 15495.72 |
| Aromaticity | 0.09 |
| Instability | 41.25 |
| Isoelectric Point | 9.43 |
| Sequence | ITHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEA |
| Description | Transcription elongation factor SPT5 |
|---|---|
| Organism | Homo sapiens |
| Chain | J |
| Length | 4 |
| Binding Area (Å2) | 283.06 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 489.59 |
| Aromaticity | 0.00 |
| Instability | 84.95 |
| Isoelectric Point | 9.47 |
| Sequence | SRPM |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S146) |
Contact cluster (C455) |
Interface cluster (I451) |
|---|---|---|---|
| 4l1u-I-E | |||
| 5eo0-C-A | |||
| 5eo1-C-A | |||
| 6b27-G-A | |||
| 1a1n-C-A | |||
| 6b27-H-B | |||
| 1qvo-C-A | |||
| 6b27-I-C | |||
| 1qvo-F-D | |||
| 6b27-J-D | |||
| 3rl2-C-A | |||
| 6b27-K-E | |||
| 6b27-L-F | |||
| 4lnr-C-A | |||
| 4o56-B-A | |||
| 4u1k-C-A | |||
| 4u1k-F-D | |||
| 4u1l-C-A | |||
| 4u1l-F-D | |||
| 4u1m-C-A | |||
| 4u1n-C-A |