5YBA-D-C

PDB Title DIMERIC CYCLOPHILIN FROM T.VAGINALIS IN COMPLEX WITH MYB1 PEPTIDE
Resolution (Å) 2.060
Classification ISOMERASE

Protein

Description Peptidyl-prolyl cis-trans isomerase
Organism Trichomonas vaginalis
Chain C
Length 175
Binding Area (Å2) 280.98
Molecular Weight 19333.09
Aromaticity 0.10
Instability 19.36
Isoelectric Point 7.80
Sequence GSMLKRPKTFFDISIRGDKVGKIVFELFNDIVPKTAENFRALCTGEKGIGKSGMPLSYKGTMFHRIIPQFMIQGGDFTRFNGTGGESIYGMKFDDENFKVKHDKPGLLSMANAGPNTNGSQFFITTVETPWLDGHHCVFGQVIEGMDIVKQIESCGTESGRPRAMCMVTDCGEMK

Peptide

Description Myb1 peptide
Organism Trichomonas vaginalis
Chain D
Length 5
Binding Area (Å2) 410.33
Hydrophobic (% a.a.)
40%
Molecular Weight 592.64
Aromaticity 0.20
Instability -8.98
Isoelectric Point 6.10
Sequence EYGPK

Clustering Classification

Sequence cluster S 1694
Contact cluster C37
Interface cluster I29

Similar complexes

Is the complex classified in the same cluster?

Complex Sequence cluster
(S1694)
Contact cluster
(C37)
Interface cluster
(I29)
1awv-K-E
1awv-L-F
1awq-B-A
5yba-B-A
1awr-G-A
1awr-H-B
1awr-I-C
1awr-J-D
1awr-K-E
1awr-L-F
1awu-B-A
1awv-G-A
1awv-H-B
1awv-I-C
1awv-J-D
2ms4-B-A
4dgb-B-A
6i42-B-A