| Description | Exportin-1 |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 127 |
| Binding Area (Å2) | 794.68 |
| Molecular Weight | 14792.14 |
| Aromaticity | 0.09 |
| Instability | 60.63 |
| Isoelectric Point | 7.12 |
| Sequence | ISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQV |
| Description | cAMP-dependent protein kinase inhibitor alpha |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 27 |
| Binding Area (Å2) | 871.80 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2747.00 |
| Aromaticity | 0.00 |
| Instability | 41.66 |
| Isoelectric Point | 4.25 |
| Sequence | GSASGNLNELALKLAGLDINKTEGEEC |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S232) |
Contact cluster (C31) |
Interface cluster (I28) |
|---|---|---|---|
| 5xoj-D-C | |||
| 5uwu-D-C | |||
| 5uww-D-C | |||
| 6a3a-D-C | |||
| 5dhf-D-C | |||
| 6a3c-D-C | |||
| 5di9-D-C | |||
| 6cit-D-C | |||
| 5dif-D-C | |||
| 5uwh-D-C | |||
| 5uwi-D-C | |||
| 5uwj-D-C | |||
| 5uwo-D-C | |||
| 5uwp-D-C | |||
| 5uwq-D-C | |||
| 5uwr-D-C | |||
| 5uws-D-C | |||
| 5uwt-D-C | |||
| 3wyg-D-C |