| Description | RNA-binding protein 5 |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 64 |
| Binding Area (Å2) | 458.39 |
| Molecular Weight | 7434.76 |
| Aromaticity | 0.23 |
| Instability | 42.02 |
| Isoelectric Point | 3.76 |
| Sequence | GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAES |
| Description | Survival motor neuron protein |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 11 |
| Binding Area (Å2) | 540.66 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1134.35 |
| Aromaticity | 0.00 |
| Instability | 56.84 |
| Isoelectric Point | 12.00 |
| Sequence | GMRPPPPGIRG |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S195) |
Contact cluster (C1380) |
Interface cluster (I1433) |
|---|---|---|---|
| 2d1x-P-A | |||
| 4btb-C-A | |||
| 5lvf-B-A | |||
| 2d1x-Q-C | |||
| 4bxr-C-A | |||
| 6e5x-B-A | |||
| 6evm-C-A | |||
| 2jkg-P-A | |||
| 4bxr-D-B | |||
| 6evn-C-A | |||
| 2jma-B-A | |||
| 4cc3-B-A | |||
| 6evo-C-A | |||
| 2kym-B-A | |||
| 4f00-B-A | |||
| 6evp-C-A | |||
| 2lcs-B-A | |||
| 4j9c-B-A | |||
| 6f55-B-A | |||
| 2o9v-B-A | |||
| 4j9f-B-A | |||
| 6h6d-C-A | |||
| 2qyf-E-A | |||
| 4j9f-D-A | |||
| 6h6d-F-D | |||
| 2qyf-F-C | |||
| 4j9f-F-E | |||
| 6h6h-C-A | |||
| 2rqw-B-A | |||
| 4jwd-C-B | |||
| 6h6h-F-D | |||
| 1fyn-B-A | |||
| 2v8c-C-A | |||
| 4ld3-B-A | |||
| 6iqj-D-B | |||
| 1klq-B-A | |||
| 2vkn-C-A | |||
| 4ln2-B-A | |||
| 6j68-C-A | |||
| 1l2z-B-A | |||
| 2zne-D-B | |||
| 4lnp-B-A | |||
| 6j68-D-B | |||
| 1wa7-B-A | |||
| 3d9o-Z-B | |||
| 4qt7-B-A | |||
| 1wlp-A-B | |||
| 3ua7-F-D | |||
| 4ux9-I-D | |||
| 2ak5-D-B | |||
| 4bt9-C-A | |||
| 5ev0-D-B |