| Description | Regulator of Ty1 transposition protein 103 |
|---|---|
| Organism | Saccharomyces cerevisiae |
| Chain | A |
| Length | 142 |
| Binding Area (Å2) | 644.40 |
| Molecular Weight | 16539.86 |
| Aromaticity | 0.08 |
| Instability | 51.05 |
| Isoelectric Point | 9.77 |
| Sequence | MAFSSEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFGKVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEHHHHHH |
| Description | PRO-SER-TYR-SER-PRO-PTH-SER-PRO-SER-TYR-SER-PRO-THR-SER-PRO-SER |
|---|---|
| Organism | Saccharomyces cerevisiae |
| Chain | B |
| Length | 15 |
| Binding Area (Å2) | 775.67 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1540.58 |
| Aromaticity | 0.13 |
| Instability | 177.87 |
| Isoelectric Point | 5.95 |
| Sequence | PSYSPSPSYSPTSPS |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S195) |
Contact cluster (C1374) |
Interface cluster (I1423) |
|---|---|---|---|
| 4jwd-C-B | |||
| 6h6h-C-A | |||
| 2rqw-B-A | |||
| 4ld3-B-A | |||
| 6h6h-F-D | |||
| 1fyn-B-A | |||
| 2v8c-C-A | |||
| 4ln2-B-A | |||
| 6iqj-D-B | |||
| 1klq-B-A | |||
| 2vkn-C-A | |||
| 4lnp-B-A | |||
| 6j68-C-A | |||
| 1l2z-B-A | |||
| 2zne-D-B | |||
| 4qt7-B-A | |||
| 6j68-D-B | |||
| 1wa7-B-A | |||
| 3d9o-Z-B | |||
| 4ux9-I-D | |||
| 1wlp-A-B | |||
| 3ua7-F-D | |||
| 5ev0-D-B | |||
| 2ak5-D-B | |||
| 4bt9-C-A | |||
| 5mf9-B-A | |||
| 2d1x-P-A | |||
| 4btb-C-A | |||
| 6e5x-B-A | |||
| 2d1x-Q-C | |||
| 4bxr-C-A | |||
| 6evm-C-A | |||
| 2jkg-P-A | |||
| 4bxr-D-B | |||
| 6evn-C-A | |||
| 2jma-B-A | |||
| 4cc3-B-A | |||
| 6evo-C-A | |||
| 2kym-B-A | |||
| 4f00-B-A | |||
| 4j9c-B-A | |||
| 6evp-C-A | |||
| 2lcs-B-A | |||
| 4j9f-B-A | |||
| 6f55-B-A | |||
| 2o9v-B-A | |||
| 4j9f-D-A | |||
| 6h6d-C-A | |||
| 2qyf-E-A | |||
| 4j9f-F-E | |||
| 6h6d-F-D | |||
| 2qyf-F-C |