Description | PHD finger protein 21A |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 62 |
Binding Area (Å2) | 481.25 |
Molecular Weight | - |
Aromaticity | 0.05 |
Instability | - |
Isoelectric Point | 6.97 |
Sequence | HMIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIXX |
Description | Histone H3 |
---|---|
Organism | Homo sapiens |
Chain | E |
Length | 10 |
Binding Area (Å2) | 607.02 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1146.30 |
Aromaticity | 0.00 |
Instability | 32.64 |
Isoelectric Point | 12.02 |
Sequence | ARTKQTARKS |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S46) |
Contact cluster (C1013) |
Interface cluster (I931) |
---|---|---|---|
2co0-B-A | |||
4gnf-C-A | |||
2co0-D-C | |||
4lk9-B-A | |||
2h9m-B-A | |||
4ouc-B-A | |||
2ke1-B-A | |||
4qbr-P-A | |||
2lgg-B-A | |||
4qbr-E-C | |||
3asl-B-A | |||
5f6k-M-C | |||
3o37-F-B | |||
5fb1-C-A | |||
3qlc-C-A | |||
5hh7-P-A | |||
3shb-B-A | |||
6e83-A-B | |||
3sou-D-A | |||
6ieu-C-A | |||
3sou-E-B | |||
3uef-B-A | |||
3v43-Q-A | |||
3zvy-C-A | |||
3zvy-D-B | |||
4gne-B-A |