Description | TPR repeat-containing protein associated with Hsp90 |
---|---|
Organism | Saccharomyces cerevisiae |
Chain | A |
Length | 111 |
Binding Area (Å2) | 340.25 |
Molecular Weight | 12511.04 |
Aromaticity | 0.08 |
Instability | 33.55 |
Isoelectric Point | 6.09 |
Sequence | MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS |
Description | C-terminus Hsp90 chaperone peptide MEEVD |
---|---|
Organism | synthetic construct |
Chain | B |
Length | 5 |
Binding Area (Å2) | 478.97 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 621.66 |
Aromaticity | 0.00 |
Instability | 43.14 |
Isoelectric Point | 3.88 |
Sequence | MEEVD |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S148) |
Contact cluster (C910) |
Interface cluster (I847) |
---|---|---|---|
5njx-B-A | |||
6fdp-B-A | |||
1elr-B-A | |||
6hpg-a-A | |||
2bug-B-A | |||
6hpg-c-C | |||
2lsv-B-A | |||
6hpg-d-D | |||
3fp2-Q-A | |||
6hpg-e-E | |||
3lca-Q-A | |||
3m5m-C-B | |||
4aif-D-A | |||
4aif-E-B | |||
4cgq-Q-A | |||
4cgu-C-A | |||
5mgx-A-F | |||
5mgx-B-G | |||
5mgx-C-E | |||
5mgx-D-H |