Description | Gamma-aminobutyric acid receptor-associated protein-like 1 |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 114 |
Binding Area (Å2) | 614.73 |
Molecular Weight | 13747.51 |
Aromaticity | 0.16 |
Instability | 36.20 |
Isoelectric Point | 7.87 |
Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
Description | Cysteine protease ATG4B |
---|---|
Organism | Homo sapiens |
Chain | G |
Length | 10 |
Binding Area (Å2) | 766.70 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1209.26 |
Aromaticity | 0.10 |
Instability | 78.50 |
Isoelectric Point | 3.39 |
Sequence | EDEDFEILSL |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S212) |
Contact cluster (C1556) |
Interface cluster (I45) |
---|---|---|---|
5lxh-E-A | |||
5lxh-F-B | |||
6hol-D-B | |||
2l8j-B-A | |||
4xc2-F-B | |||
5azf-C-A | |||
5l83-C-B | |||
5l83-D-A | |||
5yip-B-A | |||
6a9x-A-D | |||
6aaf-B-A | |||
6hoi-F-B | |||
6hol-C-A | |||
6j2i-C-A | |||
3l6x-B-A | |||
6j2i-F-D | |||
5nq0-C-A | |||
5nq1-C-A | |||
5nq1-F-D | |||
1ty4-D-B |