Description | SH3 and cysteine-rich domain-containing protein 2 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 114 |
Binding Area (Å2) | 436.83 |
Molecular Weight | 12852.45 |
Aromaticity | 0.11 |
Instability | 38.02 |
Isoelectric Point | 7.93 |
Sequence | ANSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRDGFIRVSSGKKRGLVPVDALTEI |
Description | Voltage-dependent L-type calcium channel subunit alpha-1S |
---|---|
Organism | Homo sapiens |
Chain | H |
Length | 11 |
Binding Area (Å2) | 558.93 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1258.47 |
Aromaticity | 0.00 |
Instability | 101.04 |
Isoelectric Point | 10.03 |
Sequence | PEIPLSPRPRP |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S146) |
Contact cluster (C124) |
Interface cluster (I147) |
---|---|---|---|
6b27-K-E | |||
6b27-L-F | |||
6b27-G-A | |||
6b27-I-C | |||
6b27-J-D | |||
1qvo-F-D | |||
3rl2-C-A | |||
4l1u-J-F | |||
4lnr-C-A | |||
4o56-B-A | |||
4u1k-C-A | |||
4u1k-F-D | |||
4u1l-C-A | |||
4u1l-F-D | |||
4u1m-C-A | |||
4u1n-C-A | |||
5eo0-C-A | |||
5eo1-C-A | |||
1a1n-C-A | |||
1qvo-C-A |