Description | RNA polymerase-associated protein RTF1 homolog |
---|---|
Organism | Homo sapiens |
Chain | F |
Length | 134 |
Binding Area (Å2) | 205.83 |
Molecular Weight | 15495.72 |
Aromaticity | 0.09 |
Instability | 41.25 |
Isoelectric Point | 9.43 |
Sequence | ITHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEA |
Description | Transcription elongation factor SPT5 |
---|---|
Organism | Homo sapiens |
Chain | J |
Length | 4 |
Binding Area (Å2) | 283.06 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 489.59 |
Aromaticity | 0.00 |
Instability | 84.95 |
Isoelectric Point | 9.47 |
Sequence | SRPM |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S146) |
Contact cluster (C455) |
Interface cluster (I451) |
---|---|---|---|
4l1u-I-E | |||
1qvo-F-D | |||
6b27-J-D | |||
3rl2-C-A | |||
6b27-K-E | |||
6b27-L-F | |||
4lnr-C-A | |||
4o56-B-A | |||
4u1k-C-A | |||
4u1k-F-D | |||
4u1l-C-A | |||
4u1l-F-D | |||
4u1m-C-A | |||
4u1n-C-A | |||
5eo0-C-A | |||
5eo1-C-A | |||
6b27-G-A | |||
1a1n-C-A | |||
6b27-H-B | |||
1qvo-C-A | |||
6b27-I-C |