Description | IGG1 FC |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 214 |
Binding Area (Å2) | 726.64 |
Molecular Weight | - |
Aromaticity | 0.09 |
Instability | - |
Isoelectric Point | 7.16 |
Sequence | GGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLXXXXX |
Description | Mini Z domain |
---|---|
Organism | Staphylococcus aureus |
Chain | Z |
Length | 34 |
Binding Area (Å2) | 736.45 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 4183.63 |
Aromaticity | 0.09 |
Instability | 41.16 |
Isoelectric Point | 6.75 |
Sequence | FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S39) |
Contact cluster (C32) |
Interface cluster (I153) |
---|---|---|---|
1l6x-B-A | |||
5u52-E-A | |||
1oqo-C-A | |||
1oqo-D-B | |||
5dj6-C-A | |||
5dj8-C-A | |||
5djc-C-A | |||
5djd-C-A | |||
5djx-F-D | |||
5djy-C-A | |||
5djz-C-A | |||
5dk0-C-A | |||
5dvl-B-A | |||
5dvn-B-A | |||
5nsc-C-A | |||
5di8-C-A | |||
6ifj-C-A | |||
5dj0-C-A | |||
6ifj-D-B | |||
5yi7-B-A | |||
5yi8-B-A |