Description | Ig gamma-1 chain C region |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 213 |
Binding Area (Å2) | 600.96 |
Molecular Weight | - |
Aromaticity | 0.09 |
Instability | - |
Isoelectric Point | 6.66 |
Sequence | GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVSTLPPSREEMTKNQVSLTCLVYGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSXXXXX |
Description | Fc-III peptide |
---|---|
Organism | synthetic construct |
Chain | C |
Length | 13 |
Binding Area (Å2) | 682.70 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1532.74 |
Aromaticity | 0.15 |
Instability | 46.72 |
Isoelectric Point | 4.35 |
Sequence | DCAWHLGELVWCT |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S171) |
Contact cluster (C32) |
Interface cluster (I53) |
---|---|---|---|
5di8-C-A | |||
5dj6-C-A | |||
5dj8-C-A | |||
5djc-C-A | |||
5djd-C-A | |||
5djx-F-D | |||
5djy-C-A | |||
5djz-C-A | |||
5dk0-C-A | |||
5dvl-B-A | |||
5dvn-B-A | |||
5nsc-C-A | |||
6ifj-C-A | |||
6ifj-D-B | |||
5u52-E-A | |||
1l6x-B-A | |||
5u52-Z-B | |||
1oqo-C-A | |||
1oqo-D-B |