| Description | Alpha-actinin-1 |
|---|---|
| Organism | Mus musculus |
| Chain | A |
| Length | 71 |
| Binding Area (Å2) | 692.82 |
| Molecular Weight | 7843.65 |
| Aromaticity | 0.10 |
| Instability | 36.51 |
| Isoelectric Point | 4.00 |
| Sequence | DTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL |
| Description | Voltage-dependent L-type calcium channel subunit alpha-1C |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 23 |
| Binding Area (Å2) | 733.34 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2913.38 |
| Aromaticity | 0.26 |
| Instability | 60.10 |
| Isoelectric Point | 10.12 |
| Sequence | GKFYATFLIQEYFRKFKKRKEQG |