| Description | Minor nucleoprotein VP30 |
|---|---|
| Organism | Zaire ebolavirus |
| Chain | B |
| Length | 112 |
| Binding Area (Å2) | 566.86 |
| Molecular Weight | 12884.79 |
| Aromaticity | 0.07 |
| Instability | 49.42 |
| Isoelectric Point | 7.01 |
| Sequence | ITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCES |
| Description | NP |
|---|---|
| Organism | Zaire ebolavirus |
| Chain | C |
| Length | 11 |
| Binding Area (Å2) | 683.45 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1167.36 |
| Aromaticity | 0.09 |
| Instability | 74.41 |
| Isoelectric Point | 9.18 |
| Sequence | PTVAPPAPVYR |