| Description | Protein-tyrosine kinase 2-beta |
|---|---|
| Organism | Homo sapiens |
| Chain | D |
| Length | 134 |
| Binding Area (Å2) | 422.22 |
| Molecular Weight | 14660.77 |
| Aromaticity | 0.01 |
| Instability | 36.87 |
| Isoelectric Point | 5.16 |
| Sequence | ANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA |
| Description | 20-mer peptide containing LD1 motif of leupaxin |
|---|---|
| Organism | Homo sapiens |
| Chain | F |
| Length | 12 |
| Binding Area (Å2) | 514.06 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1458.57 |
| Aromaticity | 0.00 |
| Instability | 63.50 |
| Isoelectric Point | 3.83 |
| Sequence | EELDALLEELER |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S152) |
Contact cluster (C475) |
Interface cluster (I156) |
|---|---|---|---|
| 4xef-C-A | |||
| 4xek-C-A | |||
| 4xev-F-D | |||
| 1ow6-F-C | |||
| 2b1j-D-B | |||
| 2k2r-B-A | |||
| 2vzd-C-A | |||
| 2vzd-D-B | |||
| 4xef-B-A | |||
| 4xef-E-D | |||
| 1f4v-D-A | |||
| 5fw5-C-A | |||
| 1nx0-C-A | |||
| 1nx0-D-B | |||
| 5w93-E-B | |||
| 1nx1-C-A | |||
| 6j19-B-A | |||
| 1nx1-D-B | |||
| 1u8t-F-B | |||
| 2b1j-C-A |