| Description | Protease |
|---|---|
| Organism | Human mastadenovirus D |
| Chain | A |
| Length | 205 |
| Binding Area (Å2) | 735.98 |
| Molecular Weight | - |
| Aromaticity | 0.11 |
| Instability | - |
| Isoelectric Point | 8.90 |
| Sequence | SGSSEQELAAIVRDLGCGPYFLGTHDKRFPGFLAGNKLACAIVNTAGRETGGVHWLAFGWNPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALALSPDRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLLTGVPNGMLQSPQVLPTLRRNQEKLYRFLAHHSPYFRSHRAAIEHATAFDKMKQLX |
| Description | PVI |
|---|---|
| Organism | Human mastadenovirus D |
| Chain | B |
| Length | 11 |
| Binding Area (Å2) | 966.09 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1365.65 |
| Aromaticity | 0.09 |
| Instability | 132.54 |
| Isoelectric Point | 11.01 |
| Sequence | GVKSLKRRRCY |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S217) |
Contact cluster (C68) |
Interface cluster (I61) |
|---|---|---|---|
| 1nln-B-A | |||
| 4pie-B-A | |||
| 4piq-B-A | |||
| 4pis-B-A | |||
| 4wx4-C-A | |||
| 4wx6-B-A | |||
| 4wx6-D-C | |||
| 4wx7-D-C | |||
| 5fgy-B-A | |||
| 4pid-B-A | |||
| 5n4u-B-A | |||
| 6qxk-A-B | |||
| 2bzk-A-B | |||
| 5n4v-D-A | |||
| 2c3i-A-B | |||
| 5n4x-B-A | |||
| 2ynr-B-A | |||
| 5n4z-B-A | |||
| 2ynr-C-A | |||
| 5n50-B-A | |||
| 2yns-C-A | |||
| 5n51-B-A | |||
| 2yns-D-B | |||
| 5n52-B-A | |||
| 3cxw-B-A | |||
| 4yi0-A-C | |||
| 5n5l-B-A | |||
| 3cy2-B-A | |||
| 5ctt-B-A | |||
| 5n5m-B-A | |||
| 3cy3-B-A | |||
| 5ekf-B-A | |||
| 5ndt-B-A | |||
| 3jpv-B-A | |||
| 5ekf-C-A | |||
| 5x8n-B-A | |||
| 3ma3-B-A | |||
| 6pcw-B-A | |||
| 3qf9-B-A | |||
| 5mzl-B-A | |||
| 6pdi-B-A | |||
| 4gw8-B-A | |||
| 5n4n-B-A | |||
| 6pdn-B-A | |||
| 4jx7-B-A | |||
| 5n4o-B-A | |||
| 6pdo-B-A | |||
| 5n4r-E-A | |||
| 6pdp-B-A |