| Description | Agglutinin alpha chain |
|---|---|
| Organism | Maclura pomifera |
| Chain | A |
| Length | 135 |
| Binding Area (Å2) | 460.77 |
| Molecular Weight | - |
| Aromaticity | 0.16 |
| Instability | - |
| Isoelectric Point | 4.89 |
| Sequence | GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITGFKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTNGTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSLXX |
| Description | Agglutinin beta-2 chain |
|---|---|
| Organism | Maclura pomifera |
| Chain | B |
| Length | 14 |
| Binding Area (Å2) | 558.03 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1457.59 |
| Aromaticity | 0.07 |
| Instability | 16.04 |
| Isoelectric Point | 6.09 |
| Sequence | NGKSQSIIVGPWGD |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S13) |
Contact cluster (C1111) |
Interface cluster (I151) |
|---|---|---|---|
| 1jot-B-A | |||
| 1pxd-B-A | |||
| 1ugx-B-A | |||
| 3lly-B-A | |||
| 1dxp-C-A | |||
| 3p8n-D-B | |||
| 1dxp-D-B | |||
| 3p8o-C-A | |||
| 1awq-B-A | |||
| 1dy8-C-A | |||
| 3p8o-D-B | |||
| 1awr-G-A | |||
| 1dy8-D-B | |||
| 4i31-C-A | |||
| 1awr-H-B | |||
| 1dy9-C-A | |||
| 4i31-D-B | |||
| 1awr-I-C | |||
| 1dy9-D-B | |||
| 4i32-C-A | |||
| 1awr-J-D | |||
| 4i32-D-B | |||
| 1awr-K-E | |||
| 4i33-C-A | |||
| 1awr-L-F | |||
| 4i33-D-B | |||
| 1awu-B-A | |||
| 1w3c-C-A | |||
| 4iim-E-B | |||
| 1awv-G-A | |||
| 1w3c-D-B | |||
| 4jmy-C-A | |||
| 1awv-H-B | |||
| 3kee-F-B | |||
| 4jmy-D-B | |||
| 1awv-I-C | |||
| 3kee-G-C | |||
| 4ktc-B-A | |||
| 1awv-J-D | |||
| 3kee-H-D | |||
| 4ktc-D-C | |||
| 1awv-K-E | |||
| 1awv-L-F | |||
| 3p8n-C-A |