| Description | HIV-1 CAPSID PROTEIN |
|---|---|
| Organism | Human immunodeficiency virus 1 |
| Chain | A |
| Length | 81 |
| Binding Area (Å2) | 563.71 |
| Molecular Weight | 8908.12 |
| Aromaticity | 0.06 |
| Instability | 41.27 |
| Isoelectric Point | 7.71 |
| Sequence | TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTATLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKA |
| Description | Peptide Inhibitor of capsid assembly |
|---|---|
| Organism | - |
| Chain | T |
| Length | 11 |
| Binding Area (Å2) | 631.11 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1348.45 |
| Aromaticity | 0.27 |
| Instability | 41.32 |
| Isoelectric Point | 3.49 |
| Sequence | ITFEDLLDYYG |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S206) |
Contact cluster (C163) |
Interface cluster (I159) |
|---|---|---|---|
| 2xxm-T-A | |||
| 3ds0-T-A | |||
| 3ds4-T-A | |||
| 2buo-T-A | |||
| 2flw-B-A | |||
| 2xo4-D-A | |||
| 5vax-E-A | |||
| 2fmf-B-A | |||
| 2xo4-E-B | |||
| 5vax-F-B | |||
| 2fmh-B-A | |||
| 2xo4-F-C | |||
| 5vax-G-C | |||
| 2fmi-B-A | |||
| 5vax-H-D | |||
| 2fmk-B-A | |||
| 5vay-F-B | |||
| 2p1l-B-A | |||
| 5vay-H-D | |||
| 2p1l-D-C | |||
| 3dvu-C-A | |||
| 6dcn-D-A | |||
| 2p1l-F-E | |||
| 4mi8-C-A | |||
| 6dcn-C-B | |||
| 2p1l-H-G | |||
| 4mi8-D-B | |||
| 6dco-C-A | |||
| 2pon-A-B | |||
| 4u7e-A-B | |||
| 6dco-D-B | |||
| 2x0x-D-A | |||
| 4u7i-B-A | |||
| 6mt3-B-A | |||
| 2x0x-E-B | |||
| 4u7y-B-A | |||
| 6mt4-C-A | |||
| 2x0x-F-C | |||
| 4wzx-E-A | |||
| 6mt5-C-A | |||
| 2xap-D-A | |||
| 5t6y-C-A | |||
| 6mt6-B-A | |||
| 2fka-B-A | |||
| 2xap-E-B | |||
| 5vau-F-B | |||
| 6mtl-C-A | |||
| 2flk-B-A | |||
| 2xap-F-C | |||
| 5vau-H-D | |||
| 6tzc-C-B |