| Description | 50S ribosomal protein L10 |
|---|---|
| Organism | Thermotoga maritima |
| Chain | A |
| Length | 174 |
| Binding Area (Å2) | 579.76 |
| Molecular Weight | 19745.87 |
| Aromaticity | 0.10 |
| Instability | 31.75 |
| Isoelectric Point | 9.32 |
| Sequence | RQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTLLNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGKKFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSGILRNLVYVLNAIKEKK |
| Description | 50S ribosomal protein L7/L12 |
|---|---|
| Organism | Thermotoga maritima |
| Chain | V |
| Length | 30 |
| Binding Area (Å2) | 626.81 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 3405.95 |
| Aromaticity | 0.03 |
| Instability | 47.81 |
| Isoelectric Point | 4.38 |
| Sequence | MTIDEIIEAIEKLTVSELAELVKKLEDKFG |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S57) |
Contact cluster (C730) |
Interface cluster (I713) |
|---|---|---|---|
| 1zav-Z-A | |||
| 4xek-C-A | |||
| 1zaw-U-A | |||
| 4xev-F-D | |||
| 1zaw-V-A | |||
| 1zaw-W-A | |||
| 1zaw-X-A | |||
| 1zaw-Y-A | |||
| 1zaw-Z-A | |||
| 1zax-U-A | |||
| 1zax-W-A | |||
| 1ow6-D-A | |||
| 1zax-X-A | |||
| 1ow6-F-C | |||
| 1zax-Y-A | |||
| 1zav-U-A | |||
| 1zax-Z-A | |||
| 1zav-V-A | |||
| 2vzi-A-B | |||
| 1zav-W-A | |||
| 3rqg-E-C | |||
| 1zav-X-A | |||
| 3zrj-X-A | |||
| 1zav-Y-A | |||
| 3zrj-Y-B |