| Description | Calmodulin |
|---|---|
| Organism | Drosophila melanogaster |
| Chain | A |
| Length | 148 |
| Binding Area (Å2) | 1457.64 |
| Molecular Weight | - |
| Aromaticity | 0.07 |
| Instability | - |
| Isoelectric Point | 4.06 |
| Sequence | LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSXXXX |
| Description | Target Sequence of rat Calmodulin-Dependent Protein Kinase I |
|---|---|
| Organism | Rattus norvegicus |
| Chain | E |
| Length | 25 |
| Binding Area (Å2) | 1864.18 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2988.56 |
| Aromaticity | 0.12 |
| Instability | 14.34 |
| Isoelectric Point | 12.05 |
| Sequence | IKKNFAKSKWKQAFNATAVVRHMRK |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S681) |
Contact cluster (C10) |
Interface cluster (I15) |
|---|---|---|---|
| 1mxe-F-B | |||
| 3bya-B-A | |||
| 1cdm-B-A | |||
| 3dve-B-A | |||
| 3dvk-B-A | |||
| 1cm1-B-A | |||
| 3ewt-E-A | |||
| 1cm4-B-A | |||
| 3gof-C-A | |||
| 3gof-D-B | |||
| 1iwq-B-A | |||
| 3sui-B-A | |||
| 2hqw-B-A | |||
| 1niw-D-C | |||
| 2k0f-B-A | |||
| 1niw-F-E | |||
| 4q5u-C-A | |||
| 1niw-H-G | |||
| 4upu-B-A | |||
| 2l7l-B-A | |||
| 1wrz-B-A | |||
| 1yr5-B-A | |||
| 1zuz-B-A | |||
| 1cdl-E-A | |||
| 2fot-C-A | |||
| 1sy9-B-A | |||
| 2ll6-B-A | |||
| 2bbm-B-A | |||
| 2bbn-B-A | |||
| 2y4v-B-A | |||
| 2bcx-B-A | |||
| 6dae-C-A | |||
| 2be6-D-A | |||
| 6daf-C-A | |||
| 1ckk-B-A | |||
| 2be6-E-B | |||
| 6daf-D-B | |||
| 2be6-F-C | |||
| 6sz5-B-A | |||
| 2f3y-B-A | |||
| 6u3a-C-A | |||
| 1iq5-B-A | |||
| 2f3z-B-A | |||
| 6u3a-D-B | |||
| 6y4o-B-A | |||
| 4djc-B-A | |||
| 6y4p-B-A | |||
| 4m1l-B-A | |||
| 2kdu-B-A | |||
| 2l1w-B-A | |||
| 5nin-C-A | |||
| 5nin-D-B | |||
| 2m5e-B-A | |||
| 6dad-C-A | |||
| 2mgu-M-A | |||
| 6dad-D-B | |||
| 6dae-D-B |