Description | SH3 and cysteine-rich domain-containing protein 2 |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 118 |
Binding Area (Å2) | 458.65 |
Molecular Weight | 13253.87 |
Aromaticity | 0.10 |
Instability | 40.08 |
Isoelectric Point | 7.92 |
Sequence | ANSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI |
Description | Voltage-dependent L-type calcium channel subunit alpha-1S |
---|---|
Organism | Homo sapiens |
Chain | J |
Length | 10 |
Binding Area (Å2) | 558.41 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1134.28 |
Aromaticity | 0.00 |
Instability | 117.68 |
Isoelectric Point | 4.53 |
Sequence | EPEIPLSPRP |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S146) |
Contact cluster (C127) |
Interface cluster (I147) |
---|---|---|---|
6b27-G-A | |||
6b27-H-B | |||
6b27-I-C | |||
6b27-K-E | |||
6b27-L-F | |||
4u1k-C-A | |||
4u1k-F-D | |||
4u1l-C-A | |||
4u1l-F-D | |||
4u1m-C-A | |||
4u1n-C-A | |||
5eo0-C-A | |||
5eo1-C-A | |||
1a1n-C-A | |||
1qvo-C-A | |||
1qvo-F-D | |||
3rl2-C-A | |||
4l1u-J-F | |||
4lnr-C-A | |||
4o56-B-A |