Description | Exportin-1 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 127 |
Binding Area (Å2) | 794.68 |
Molecular Weight | 14792.14 |
Aromaticity | 0.09 |
Instability | 60.63 |
Isoelectric Point | 7.12 |
Sequence | ISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQV |
Description | cAMP-dependent protein kinase inhibitor alpha |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 27 |
Binding Area (Å2) | 871.80 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 2747.00 |
Aromaticity | 0.00 |
Instability | 41.66 |
Isoelectric Point | 4.25 |
Sequence | GSASGNLNELALKLAGLDINKTEGEEC |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S232) |
Contact cluster (C30) |
Interface cluster (I28) |
---|---|---|---|
5xoj-D-C | |||
5di9-D-C | |||
6cit-D-C | |||
5dif-D-C | |||
5uwh-D-C | |||
5uwi-D-C | |||
5uwj-D-C | |||
5uwo-D-C | |||
5uwp-D-C | |||
5uwq-D-C | |||
5uwr-D-C | |||
5uws-D-C | |||
5uwt-D-C | |||
5uwu-D-C | |||
5uww-D-C | |||
6a3a-D-C | |||
5dhf-D-C | |||
6a3c-D-C | |||
3wyg-D-C |