Description | Chemotaxis protein cheY |
---|---|
Organism | Escherichia coli |
Chain | B |
Length | 122 |
Binding Area (Å2) | 472.35 |
Molecular Weight | 13214.96 |
Aromaticity | 0.07 |
Instability | 24.39 |
Isoelectric Point | 5.23 |
Sequence | ADKELKFLVVDKFSTRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNPNDGLELLKTIRADGASALPVLVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLG |
Description | Flagellar motor switch protein fliM |
---|---|
Organism | Escherichia coli |
Chain | F |
Length | 13 |
Binding Area (Å2) | 538.12 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1386.55 |
Aromaticity | 0.00 |
Instability | 53.68 |
Isoelectric Point | 3.67 |
Sequence | SILSQAEIDALLN |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S152) |
Contact cluster (C699) |
Interface cluster (I60) |
---|---|---|---|
1f4v-D-A | |||
2b1j-C-A | |||
2b1j-D-B | |||
2fka-B-A | |||
2flk-B-A | |||
2flw-B-A | |||
2fmf-B-A | |||
2fmh-B-A | |||
2fmi-B-A | |||
2fmk-B-A | |||
2vzd-C-A | |||
2vzd-D-B | |||
1nx0-C-A | |||
4xef-B-A | |||
1nx0-D-B | |||
4xef-C-A | |||
1nx1-C-A | |||
4xef-E-D | |||
1nx1-D-B | |||
4xef-F-D | |||
5fw5-C-A | |||
5w93-E-B | |||
6j19-B-A | |||
2k2r-B-A |