Description | Protein-tyrosine kinase 2-beta |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 136 |
Binding Area (Å2) | 461.26 |
Molecular Weight | 14929.11 |
Aromaticity | 0.01 |
Instability | 36.76 |
Isoelectric Point | 5.36 |
Sequence | MANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH |
Description | 20-mer peptide containing LD1 motif of leupaxin |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 13 |
Binding Area (Å2) | 562.92 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1589.76 |
Aromaticity | 0.00 |
Instability | 59.38 |
Isoelectric Point | 3.83 |
Sequence | MEELDALLEELER |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S152) |
Contact cluster (C475) |
Interface cluster (I156) |
---|---|---|---|
4xef-F-D | |||
4xek-C-A | |||
4xev-F-D | |||
1ow6-F-C | |||
1f4v-D-A | |||
5fw5-C-A | |||
1nx0-C-A | |||
5w93-E-B | |||
1nx0-D-B | |||
6j19-B-A | |||
1nx1-C-A | |||
1nx1-D-B | |||
1u8t-F-B | |||
2b1j-C-A | |||
2b1j-D-B | |||
2k2r-B-A | |||
2vzd-C-A | |||
2vzd-D-B | |||
4xef-B-A | |||
4xef-E-D |