Description | Protease |
---|---|
Organism | Human mastadenovirus D |
Chain | A |
Length | 203 |
Binding Area (Å2) | 706.00 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 8.73 |
Sequence | SGSSEQELAAIVRDLGCGPYFLGTHDKRFPGFLAGNKLACAIVNTAGRETGGVHWLAFGWNPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALALSPDRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLLTGVPNGMLQSPQVLPTLRRNQEKLYRFLAHHSPYFRSHRAAIEHATAFDKMXX |
Description | peptide |
---|---|
Organism | synthetic construct |
Chain | C |
Length | 11 |
Binding Area (Å2) | 936.39 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1365.65 |
Aromaticity | 0.09 |
Instability | 124.82 |
Isoelectric Point | 11.01 |
Sequence | VKSLKRRRCYG |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S217) |
Contact cluster (C68) |
Interface cluster (I61) |
---|---|---|---|
4piq-B-A | |||
4pis-B-A | |||
4wx6-B-A | |||
4wx6-D-C | |||
4wx7-B-A | |||
4wx7-D-C | |||
5fgy-B-A | |||
4pid-B-A | |||
4pie-B-A | |||
1nln-B-A | |||
5n4v-D-A | |||
2bzk-A-B | |||
5n4x-B-A | |||
2c3i-A-B | |||
5n4z-B-A | |||
2ynr-B-A | |||
5n50-B-A | |||
2ynr-C-A | |||
5n51-B-A | |||
2yns-C-A | |||
5n52-B-A | |||
2yns-D-B | |||
4yi0-A-C | |||
5n5l-B-A | |||
3cxw-B-A | |||
5ctt-B-A | |||
5n5m-B-A | |||
3cy2-B-A | |||
5ekf-B-A | |||
5ndt-B-A | |||
3cy3-B-A | |||
5ekf-C-A | |||
5x8n-B-A | |||
3jpv-B-A | |||
6pcw-B-A | |||
3ma3-B-A | |||
3qf9-B-A | |||
5mzl-B-A | |||
6pdi-B-A | |||
4gw8-B-A | |||
5n4n-B-A | |||
6pdn-B-A | |||
4jx7-B-A | |||
5n4o-B-A | |||
6pdo-B-A | |||
5n4r-E-A | |||
6pdp-B-A | |||
5n4u-B-A | |||
6qxk-A-B |