Description | Sorbin and SH3 domain-containing protein 1 |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 66 |
Binding Area (Å2) | 386.49 |
Molecular Weight | 7694.72 |
Aromaticity | 0.12 |
Instability | 12.27 |
Isoelectric Point | 6.18 |
Sequence | MVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPL |
Description | proline rich peptide |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 10 |
Binding Area (Å2) | 472.36 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1058.27 |
Aromaticity | 0.00 |
Instability | 95.88 |
Isoelectric Point | 6.22 |
Sequence | LAPPKPPLPE |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S195) |
Contact cluster (C1246) |
Interface cluster (I363) |
---|---|---|---|
2o9v-B-A | |||
2ak5-D-B | |||
4bt9-C-A | |||
5lvf-B-A | |||
2d1x-P-A | |||
4btb-C-A | |||
5mf9-B-A | |||
2d1x-Q-C | |||
4bxr-C-A | |||
6e5x-B-A | |||
2jkg-P-A | |||
4bxr-D-B | |||
6evm-C-A | |||
2jma-B-A | |||
4cc3-B-A | |||
6evn-C-A | |||
2kym-B-A | |||
4f00-B-A | |||
6evo-C-A | |||
2lcs-B-A | |||
4j9c-B-A | |||
6evp-C-A | |||
4j9f-B-A | |||
6f55-B-A | |||
2qyf-E-A | |||
4j9f-D-A | |||
6h6d-C-A | |||
2qyf-F-C | |||
4j9f-F-E | |||
6h6d-F-D | |||
2rqw-B-A | |||
4jwd-C-B | |||
6h6h-C-A | |||
1fyn-B-A | |||
2v8c-C-A | |||
4ld3-B-A | |||
6h6h-F-D | |||
1klq-B-A | |||
2vkn-C-A | |||
4lnp-B-A | |||
6iqj-D-B | |||
1l2z-B-A | |||
2zne-D-B | |||
4qt7-B-A | |||
6j68-C-A | |||
1wa7-B-A | |||
3d9o-Z-B | |||
4ux9-I-D | |||
6j68-D-B | |||
1wlp-A-B | |||
3ua7-F-D | |||
5ev0-D-B |