Description | Chaperone protein DnaK |
---|---|
Organism | Escherichia coli |
Chain | A |
Length | 211 |
Binding Area (Å2) | 575.56 |
Molecular Weight | 22883.55 |
Aromaticity | 0.02 |
Instability | 37.89 |
Isoelectric Point | 5.10 |
Sequence | VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM |
Description | APO-monomer |
---|---|
Organism | - |
Chain | C |
Length | 7 |
Binding Area (Å2) | 767.18 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 898.06 |
Aromaticity | 0.14 |
Instability | 80.34 |
Isoelectric Point | 10.84 |
Sequence | RPYLPRP |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S525) |
Contact cluster (C28) |
Interface cluster (I24) |
---|---|---|---|
4ezo-C-A | |||
4ezw-E-A | |||
4ezw-F-B | |||
4ezw-G-C | |||
4ezw-H-D | |||
4ezx-C-A | |||
4ezx-D-B | |||
4ezy-B-A | |||
1dkx-B-A | |||
4ezz-B-A | |||
1dkz-B-A | |||
4f00-B-A | |||
4jwd-C-B | |||
4ezq-B-A | |||
4ezr-B-A | |||
4r5i-B-A | |||
4ezs-B-A | |||
4ezt-B-A | |||
4ezu-B-A | |||
1q5l-B-A | |||
4po2-C-A | |||
4po2-D-B |