Description | Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 149 |
Binding Area (Å2) | 901.58 |
Molecular Weight | - |
Aromaticity | 0.08 |
Instability | - |
Isoelectric Point | 9.17 |
Sequence | DELYRQSLEIISRYLREQATGAKDRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVXXXX |
Description | Mcl-1 specific peptide MB7 |
---|---|
Organism | - |
Chain | D |
Length | 23 |
Binding Area (Å2) | 1047.10 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 2792.03 |
Aromaticity | 0.13 |
Instability | 84.65 |
Isoelectric Point | 6.26 |
Sequence | RPEIWAAQEIRRIGDENNAYYAR |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S165) |
Contact cluster (C60) |
Interface cluster (I55) |
---|---|---|---|
6qfi-B-A | |||
3d7v-B-A | |||
3kz0-C-A | |||
5c6h-B-A | |||
2jm6-A-B | |||
5uum-C-A | |||
5uum-D-B | |||
2kbw-B-A | |||
2roc-B-A | |||
2rod-B-A | |||
6mbe-B-A | |||
4d2m-B-A | |||
4d2m-D-C | |||
4qvf-B-A | |||
4zie-C-A | |||
1pq1-B-A | |||
2k7w-B-A | |||
5vwv-B-A | |||
5wos-B-A | |||
2vm6-B-A | |||
3fdl-B-A | |||
3io8-B-A | |||
4b4s-B-A |