Description | Major histocompatibility complex class I glycoprotein haplotype B21 |
---|---|
Organism | Gallus gallus |
Chain | A |
Length | 274 |
Binding Area (Å2) | 716.83 |
Molecular Weight | 31092.24 |
Aromaticity | 0.11 |
Instability | 42.29 |
Isoelectric Point | 5.71 |
Sequence | ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGG |
Description | Hemoglobin subunit alpha-A |
---|---|
Organism | Gallus gallus |
Chain | C |
Length | 11 |
Binding Area (Å2) | 1101.51 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1176.19 |
Aromaticity | 0.09 |
Instability | 23.29 |
Isoelectric Point | 4.24 |
Sequence | GHAEEYGAETL |
Is the complex classified in the same cluster?