Description | Chemotaxis protein cheY |
---|---|
Organism | Salmonella enterica |
Chain | A |
Length | 128 |
Binding Area (Å2) | 349.39 |
Molecular Weight | 13994.07 |
Aromaticity | 0.07 |
Instability | 32.82 |
Isoelectric Point | 4.89 |
Sequence | ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM |
Description | C-terminal 15-mer from Chemotaxis protein cheZ |
---|---|
Organism | Salmonella enterica |
Chain | B |
Length | 13 |
Binding Area (Å2) | 408.14 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1464.53 |
Aromaticity | 0.08 |
Instability | 21.50 |
Isoelectric Point | 3.32 |
Sequence | QDQVDDLLDSLGF |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S206) |
Contact cluster (C202) |
Interface cluster (I60) |
---|---|---|---|
2flw-B-A | |||
2fmh-B-A | |||
2fmi-B-A | |||
2fka-B-A | |||
2flk-B-A | |||
2fmk-B-A | |||
2b1j-C-A | |||
2b1j-D-B | |||
1f4v-D-A | |||
1u8t-F-B | |||
2x0x-F-C | |||
4u7y-B-A | |||
6mt4-C-A | |||
2xap-D-A | |||
4wzx-E-A | |||
6mt5-C-A | |||
2buo-T-A | |||
2xap-E-B | |||
5t6y-C-A | |||
6mt6-B-A | |||
2xap-F-C | |||
5vau-F-B | |||
6mtl-C-A | |||
2xo4-D-A | |||
5vau-H-D | |||
6tzc-C-B | |||
2xo4-E-B | |||
5vax-E-A | |||
2xo4-F-C | |||
5vax-F-B | |||
2xxm-T-A | |||
5vax-G-C | |||
3ds0-T-A | |||
5vax-H-D | |||
2p1l-B-A | |||
3ds1-T-A | |||
5vay-F-B | |||
2p1l-D-C | |||
3ds4-T-A | |||
5vay-H-D | |||
2p1l-F-E | |||
3dvu-C-A | |||
6dcn-D-A | |||
2p1l-H-G | |||
4mi8-C-A | |||
6dcn-C-B | |||
2pon-A-B | |||
4mi8-D-B | |||
6dco-C-A | |||
2x0x-D-A | |||
4u7e-A-B | |||
6dco-D-B | |||
2x0x-E-B | |||
4u7i-B-A | |||
6mt3-B-A |