Description | Orphan nuclear receptor NR5A2 |
---|---|
Organism | Mus musculus |
Chain | B |
Length | 243 |
Binding Area (Å2) | 491.02 |
Molecular Weight | 28173.14 |
Aromaticity | 0.09 |
Instability | 42.66 |
Isoelectric Point | 5.54 |
Sequence | ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA |
Description | nuclear receptor subfamily 0, group B, member 2 |
---|---|
Organism | Rattus norvegicus |
Chain | D |
Length | 11 |
Binding Area (Å2) | 520.36 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1244.44 |
Aromaticity | 0.09 |
Instability | 16.26 |
Isoelectric Point | 6.46 |
Sequence | SHPTILYTLLS |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S199) |
Contact cluster (C26) |
Interface cluster (I21) |
---|---|---|---|
1zh7-C-A | |||
4dor-C-A | |||
4dor-D-B | |||
4oni-C-A | |||
4oni-D-B | |||
1yuc-C-A | |||
1yuc-D-B | |||
5syz-C-A | |||
5unj-C-A | |||
3plz-C-A | |||
3plz-D-B | |||
4dos-B-A | |||
1yok-B-A | |||
4pld-B-A | |||
4ple-B-A | |||
4ple-H-G | |||
1zdu-P-A | |||
5l11-C-A | |||
1ymt-B-A | |||
1yp0-B-A | |||
3f7d-B-A | |||
1zdt-P-A | |||
1zdt-Q-B | |||
4qjr-B-A | |||
6oqx-C-A | |||
6oqy-C-A | |||
6or1-C-A | |||
4dos-C-A | |||
1yok-C-A | |||
2q3y-B-A |